McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35G3-1:8

Chromosome

chr17

Gene Name

lnc-SLC35G3-1

Start

35234967

CPC Label

noncoding

End

35242925

Cancer

OV

Strand

-

Peptide

LGSLTPMGMHDGSPQIIEARR

Modified Peptide

n[145]LGSLTPM[147]GMHDGSPQIIEARR

Peptide Length

21

ORF Length

50

Open Reading Frame (ORF)

LHQRSPVMAVHCMPKRMVGEAVSKLGSLTPMGMHDGSPQIIEARRSQLPQ

Conservation Score

0.202

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.182021

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8375

PhyloCSF Frame 3

0

CNTI Score

-0.306218189