McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35G3-1:5

Chromosome

chr17

Gene Name

lnc-SLC35G3-1

Start

35240047

CPC Label

noncoding

End

35242921

Cancer

CCRC

Strand

-

Peptide

TLDLMICLPR

Modified Peptide

n[230]TLDLMICLPR

Peptide Length

10

ORF Length

96

Open Reading Frame (ORF)

LFVCLFVCLRRSLAVSLRLECSGAISACCNVGLRGSSNSPALASQVAGTTGTSHHAQLIFVFLVETRFHHIGHAGLRTLDLMICLPRLSKVLELQV

Conservation Score

0.082

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.393677

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9923

PhyloCSF Frame 3

0

CNTI Score

0.641821768