McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35G3-1:10

Chromosome

chr17

Gene Name

lnc-SLC35G3-1

Start

35227655

CPC Label

noncoding

End

35242925

Cancer

OSCC

Strand

-

Peptide

LLVYNIHFSGK

Modified Peptide

n[145]LLVYNIHFSGK

Peptide Length

11

ORF Length

72

Open Reading Frame (ORF)

LCFHRLSFKPKLLVYNIHFSGKNIFSTFFLFLIKSLKNKICINTYMMFLRNNVCHLTKCGEILSEQVYLKEG

Conservation Score

0.729

PhyloCSF Frame 1

-5.126

No. of Spectra

5

CPC Coding Probability

0.216362

PhyloCSF Frame 2 

-4.844

CNTI Index

noncoding

Max Probability

0.9795

PhyloCSF Frame 3

-5.164

CNTI Score

-0.306218189