McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35G3-1:1

Chromosome

chr17

Gene Name

lnc-SLC35G3-1

Start

35231880

CPC Label

coding

End

35242889

Cancer

EOGC

Strand

-

Peptide

LLSFAGAR

Modified Peptide

n[145]LLSFAGAR

Peptide Length

8

ORF Length

212

Open Reading Frame (ORF)

LAPLGVFLGRHRLGERSAGFSPGASKSFDSYSNYSVSCWKRGKGYGETRWYMGHWGEGKASLLLLVIRECCVRLLSFAGARGSDQHLPGIGVATGAKPGRLWKQRFTDRKEKLFFVFITHRRLPHARVLGGAVRFQCVSLNSSTKFVLGAGEGPGSATRGPLELPVGTARAAALCGLCGEPEGRSGPRRSTGGQENQERAAWGQIRTRAPSG

Conservation Score

0.577

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.617133

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3501

PhyloCSF Frame 3

0

CNTI Score

-0.317082854