McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35G2-2:2

Chromosome

chr3

Gene Name

lnc-SLC35G2-2

Start

136818646

CPC Label

noncoding

End

136843322

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LGEGFLR

Modified Peptide

n[145]LGEGFLR

Peptide Length

7

ORF Length

72

Open Reading Frame (ORF)

MLIPLPGESWPGLSDNPGIPWGQYRVQGQTRLGEGFLRDLEPASPAQSELQPSGKDNCENNLKGGARTEMVE

Conservation Score

0.904

PhyloCSF Frame 1

-4.663

No. of Spectra

26

CPC Coding Probability

0.0753331

PhyloCSF Frame 2 

-3.971

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

-5.026

CNTI Score

-0.307965419