McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35F5-4:1

Chromosome

chr2

Gene Name

lnc-SLC35F5-4

Start

113969477

CPC Label

noncoding

End

113972350

Cancer

CCRC

Strand

-

Peptide

LHQQTHK

Modified Peptide

LHQQTHK

Peptide Length

7

ORF Length

150

Open Reading Frame (ORF)

LGQAGLGRRCRKRPRQEENHPGDLETLFSISKLHQQTHKIVMYKTVFPNWGNKDSCRGRERYHLTIIFFSRMVLSPSHGPREKFSLSPNSHPPKKIFPGVWKCLRFTHQLEVWPASELRTEAVMRWGFAGSWGCHSRRELCVLQLWLPLP

Conservation Score

0.318

PhyloCSF Frame 1

-5.518

No. of Spectra

5

CPC Coding Probability

0.168114

PhyloCSF Frame 2 

-4.083

CNTI Index

noncoding

Max Probability

0.631

PhyloCSF Frame 3

-4.441

CNTI Score

-0.38553298