McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35F5-3:20

Chromosome

chr2

Gene Name

lnc-SLC35F5-3

Start

113872934

CPC Label

noncoding

End

113889711

Cancer

PRAD

Strand

-

Peptide

HEIMNMLHSDSHLK

Modified Peptide

HEIM[147]NMLHSDSHLK

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

LQGSHLQNVQWRHEIMNMLHSDSHLKFFKSHFHFVLFFIL

Conservation Score

1

PhyloCSF Frame 1

-5.627

No. of Spectra

5

CPC Coding Probability

0.0678295

PhyloCSF Frame 2 

-5.168

CNTI Index

noncoding

Max Probability

0.9965

PhyloCSF Frame 3

-5.538

CNTI Score

-0.341860097