McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35F5-3:13

Chromosome

chr2

Gene Name

lnc-SLC35F5-3

Start

113872934

CPC Label

noncoding

End

113889767

Cancer

OV

Strand

-

Peptide

MGQAWWLTPIIPALRETKVGGSPEVR

Modified Peptide

n[145]M[147]GQAWWLTPIIPALRETKVGGSPEVR

Peptide Length

26

ORF Length

46

Open Reading Frame (ORF)

MGQAWWLTPIIPALRETKVGGSPEVRSLRPARPTRRNPVSTKITKN

Conservation Score

0.015

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.143965

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3094

PhyloCSF Frame 3

0

CNTI Score

-0.341860097