McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35F5-14:5

Chromosome

chr2

Gene Name

lnc-SLC35F5-14

Start

113611238

CPC Label

noncoding

End

113627138

Cancer

OV

Strand

-

Peptide

AGQLEAGR

Modified Peptide

n[145]AGQLEAGR

Peptide Length

8

ORF Length

58

Open Reading Frame (ORF)

LVPSGKAGQLEAGRGLPGHREPTTRFASLRPARRLLHTCRSHAGGLDIEGREVDLGDI

Conservation Score

0.782

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.110398

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9617

PhyloCSF Frame 3

0

CNTI Score

0.706008613