McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35E3-8:1

Chromosome

chr12

Gene Name

lnc-SLC35E3-8

Start

68842440

CPC Label

noncoding

End

68844181

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LELIIFQLEPSR

Modified Peptide

n[145]LELIIFQLEPSR

Peptide Length

12

ORF Length

68

Open Reading Frame (ORF)

LELIIFQLEPSRICFFPLEVLKALLEFIILKLEPSRICFFLRSIGSINVIINIVHLIYGGSDSYFYKI

Conservation Score

0.815

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0464837

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9401

PhyloCSF Frame 3

0

CNTI Score

-0.485444398