McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35C1-83:11

Chromosome

chr11

Gene Name

lnc-SLC35C1-83

Start

45723308

CPC Label

noncoding

End

45744250

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LHLLPSVFPTNTR

Modified Peptide

n[145]LHLLPSVFPTNTR

Peptide Length

13

ORF Length

34

Open Reading Frame (ORF)

LHLLPSVFPTNTRASPLYPIHMPQKLTMTVGLFQ

Conservation Score

0.096

PhyloCSF Frame 1

-4.599

No. of Spectra

4

CPC Coding Probability

0.025051

PhyloCSF Frame 2 

-4.55

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

-4.978

CNTI Score

-0.355716157