McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35C1-8:1

Chromosome

chr11

Gene Name

lnc-SLC35C1-8

Start

45671918

CPC Label

noncoding

End

45701020

Cancer

BRCA-Basal-like

Strand

+

Peptide

GGPGTSPSAR

Modified Peptide

n[145]GGPGTSPSAR

Peptide Length

10

ORF Length

47

Open Reading Frame (ORF)

MPVASRGGPGTSPSARLMLTPPQDSPLVIAVGLLGHRFSQDGLGYPA

Conservation Score

0.866

PhyloCSF Frame 1

-3.798

No. of Spectra

38

CPC Coding Probability

0.129883

PhyloCSF Frame 2 

-4.715

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-5.016

CNTI Score

-0.312209276