McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35C1-2:1

Chromosome

chr11

Gene Name

lnc-SLC35C1-2

Start

45651325

CPC Label

noncoding

End

45652805

Cancer

CCRC

Strand

+

Peptide

LQTMVGELPARPGK

Modified Peptide

n[230]LQTM[147]VGELPARPGK

Peptide Length

14

ORF Length

74

Open Reading Frame (ORF)

LQTMVGELPARPGKVDNCVKPLPTHGCSDSPGSGLAEVSKGRGAYPGLQVERAPPGMQLGRKSSSNHTEVTPAT

Conservation Score

1

PhyloCSF Frame 1

-2.318

No. of Spectra

14

CPC Coding Probability

0.187913

PhyloCSF Frame 2 

-1.857

CNTI Index

noncoding

Max Probability

0.7036

PhyloCSF Frame 3

-2.303

CNTI Score

-0.360463222