McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35B4-5:1

Chromosome

chr7

Gene Name

lnc-SLC35B4-5

Start

133732492

CPC Label

noncoding

End

133733595

Cancer

EOGC

Strand

-

Peptide

KWQTITEVHVDVK

Modified Peptide

n[145]KWQTITEVHVDVK

Peptide Length

13

ORF Length

106

Open Reading Frame (ORF)

LLICSQVAFRKFRLITEDEQGKNCLTFMAWILPVTKYVPWSKKWQTITEVHVDVKTTDGYLLHLFCVGFTKKYNNQIQKTSYAQHQQVCQIQEIMIKTMTQKLQDR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.133858

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3115

PhyloCSF Frame 3

0

CNTI Score

-0.401051373