McDonnell Genome Institute

Washington University

Transcript

lnc-SLC35B3-5:1

Chromosome

chr6

Gene Name

lnc-SLC35B3-5

Start

9069219

CPC Label

noncoding

End

9106776

Cancer

HCC

Strand

-

Peptide

KIPDEGK

Modified Peptide

n[230]KIPDEGK

Peptide Length

7

ORF Length

68

Open Reading Frame (ORF)

MTSCRLMQNQVFDKDGRALGWIEYPPQVGRGKSSSQRKIPDEGKGTPGKNTTIDIHCTRILIMKTPKK

Conservation Score

0.785

PhyloCSF Frame 1

-4.978

No. of Spectra

3

CPC Coding Probability

0.0772615

PhyloCSF Frame 2 

-5.172

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-4.877

CNTI Score

-0.43590603