McDonnell Genome Institute

Washington University

Transcript

lnc-SLC34A2-2:1

Chromosome

chr4

Gene Name

lnc-SLC34A2-2

Start

25679888

CPC Label

noncoding

End

25713329

Cancer

EOGC

Strand

+

Peptide

LTSESQQMAVVSVILK

Modified Peptide

n[145]LTSESQQM[147]AVVSVILK

Peptide Length

16

ORF Length

56

Open Reading Frame (ORF)

MSCGLGAVPGLGSAATGQESRTTQHFQNKSLLCKLTSESQQMAVVSVILKGFCFCF

Conservation Score

0.962

PhyloCSF Frame 1

-4.121

No. of Spectra

1

CPC Coding Probability

0.101896

PhyloCSF Frame 2 

-4.735

CNTI Index

noncoding

Max Probability

0.0523

PhyloCSF Frame 3

-3.758

CNTI Score

-0.408527448