McDonnell Genome Institute

Washington University

Transcript

lnc-SLC30A9-24:2

Chromosome

chr4

Gene Name

lnc-SLC30A9-24

Start

42238704

CPC Label

noncoding

End

42251239

Cancer

CCRC

Strand

+

Peptide

LSGPHLSCLLLNPSWQK

Modified Peptide

n[230]LSGPHLSCLLLNPSWQK

Peptide Length

17

ORF Length

82

Open Reading Frame (ORF)

LSGPHLSCLLLNPSWQKVVISQYFWSKCINQTIMCKGGHRMKEQCSDLEHHATLLQLCRSVAVCACSAPLDELTKQHLRKSP

Conservation Score

0.717

PhyloCSF Frame 1

-4.145

No. of Spectra

28

CPC Coding Probability

0.465713

PhyloCSF Frame 2 

-4.603

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

-4.76

CNTI Score

-0.334839498