McDonnell Genome Institute

Washington University

Transcript

lnc-SLC30A9-24:1

Chromosome

chr4

Gene Name

lnc-SLC30A9-24

Start

42151027

CPC Label

coding

End

42268110

Cancer

CCRC

Strand

+

Peptide

SHLLGARR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

82

Open Reading Frame (ORF)

LAPLRTTPERSWSPTATAVLPGAGSKPRSHLLGARRRKPRRGGAGESSRSFRVRGEAPGAPRHPDTAQHGWKILTKQTNNES

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.878657

PhyloCSF Frame 2 

0.898

CNTI Index

noncoding

Max Probability

0.761

PhyloCSF Frame 3

0

CNTI Score

-0.271340563