McDonnell Genome Institute

Washington University

Transcript

lnc-SLC30A7-8:1

Chromosome

chr1

Gene Name

lnc-SLC30A7-8

Start

100798440

CPC Label

noncoding

End

100859849

Cancer

OSCC

Strand

+

Peptide

MNKSMYVK

Modified Peptide

n[145]MNKSMYVK

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

MNKSMYVKHLTKCLTHKNHKLPTSPIQADHSACLTKFQRFTREMYKSIE

Conservation Score

0.885

PhyloCSF Frame 1

-4.25

No. of Spectra

17

CPC Coding Probability

0.0220809

PhyloCSF Frame 2 

-5.685

CNTI Index

noncoding

Max Probability

0.8537

PhyloCSF Frame 3

-2.938

CNTI Score

-0.393823759