McDonnell Genome Institute

Washington University

Transcript

lnc-SLC30A5-2:1

Chromosome

chr5

Gene Name

lnc-SLC30A5-2

Start

68740210

CPC Label

noncoding

End

68744235

Cancer

OSCC

Strand

+

Peptide

ASMHCLTPLLK

Modified Peptide

n[145]ASM[147]HCLTPLLK

Peptide Length

11

ORF Length

48

Open Reading Frame (ORF)

LNSSVRVSLFSLFPFPVHLPCGNKSGLSKASMHCLTPLLKIPNTSNAT

Conservation Score

0.44

PhyloCSF Frame 1

-4.301

No. of Spectra

3

CPC Coding Probability

0.0295236

PhyloCSF Frame 2 

-4.84

CNTI Index

noncoding

Max Probability

0.7593

PhyloCSF Frame 3

-5.734

CNTI Score

-0.390039117