McDonnell Genome Institute

Washington University

Transcript

lnc-SLC30A4-5:4

Chromosome

chr15

Gene Name

lnc-SLC30A4-5

Start

45449703

CPC Label

noncoding

End

45456716

Cancer

EOGC

Strand

-

Peptide

ARPGPLAGESPINR

Modified Peptide

n[145]ARPGPLAGESPINR

Peptide Length

14

ORF Length

38

Open Reading Frame (ORF)

LSSYSHVLGMRAAKVNRARPGPLAGESPINRRSTITMP

Conservation Score

0.13

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.14918

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.374961954