McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A9-7:1

Chromosome

chr4

Gene Name

lnc-SLC2A9-7

Start

9553613

CPC Label

noncoding

End

9553985

Cancer

OV

Strand

-

Peptide

LDQEVHDQWTTPEETNGHQCPSPRK

Modified Peptide

n[145]LDQEVHDQWTTPEETNGHQCPSPRK

Peptide Length

25

ORF Length

51

Open Reading Frame (ORF)

LDQEVHDQWTTPEETNGHQCPSPRKGNKMYKTTMDVIFILIVGLRTRFGGG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

44

CPC Coding Probability

0.121738

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6855

PhyloCSF Frame 3

0

CNTI Score

-0.367218625