McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A3-4:1

Chromosome

chr12

Gene Name

lnc-SLC2A3-4

Start

7959476

CPC Label

noncoding

End

7970731

Cancer

LUAD

Strand

-

Peptide

KIHESFSLKR

Modified Peptide

n[230]KIHESFSLKR

Peptide Length

10

ORF Length

34

Open Reading Frame (ORF)

MPVVSNVWKRKIHESFSLKRALPLLLHISSSSSC

Conservation Score

0.096

PhyloCSF Frame 1

-4.221

No. of Spectra

6

CPC Coding Probability

0.12804

PhyloCSF Frame 2 

-4.438

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-6.566

CNTI Score

-0.338602447