McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A12-12:3

Chromosome

chr6

Gene Name

lnc-SLC2A12-12

Start

133948586

CPC Label

noncoding

End

133953053

Cancer

CCRC

Strand

-

Peptide

GDSLFQWLLPLLK

Modified Peptide

GDSLFQWLLPLLK

Peptide Length

13

ORF Length

35

Open Reading Frame (ORF)

LENNMICQGNGRGDSLFQWLLPLLKSQRYSNGDKF

Conservation Score

0.087

PhyloCSF Frame 1

-4.505

No. of Spectra

54

CPC Coding Probability

0.0711381

PhyloCSF Frame 2 

-5.602

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

-3.308

CNTI Score

-0.321949799