McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A12-12:2

Chromosome

chr6

Gene Name

lnc-SLC2A12-12

Start

133915805

CPC Label

noncoding

End

133953053

Cancer

LUAD

Strand

-

Peptide

SEMQGFLVIQGTYTEQR

Modified Peptide

n[230]SEM[147]QGFLVIQGTYTEQR

Peptide Length

17

ORF Length

89

Open Reading Frame (ORF)

LGPPGQSMTIALSSSQLQLISKFHLELYFPFPLYISHVSTREAEPVGEIHILRNLLRGIGLCDCGCWLGKSEMQGFLVIQGTYTEQRKN

Conservation Score

1

PhyloCSF Frame 1

-5.127

No. of Spectra

3

CPC Coding Probability

0.0702012

PhyloCSF Frame 2 

-4.659

CNTI Index

noncoding

Max Probability

0.4531

PhyloCSF Frame 3

-4.78

CNTI Score

-0.448255966