McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A12-11:1

Chromosome

chr6

Gene Name

lnc-SLC2A12-11

Start

133510385

CPC Label

noncoding

End

133510693

Cancer

CCRC

Strand

-

Peptide

LAGQVFR

Modified Peptide

n[230]LAGQVFR

Peptide Length

7

ORF Length

100

Open Reading Frame (ORF)

LAGQVFRKCLPLFDQVLAERSAVQTVTKGGIMLPEKHPVKALQAMIVTAGLGFKEKSGEILPISIRVGNKVFLPEYGGTKVVLNDEIISYLEMVTYLESP

Conservation Score

1

PhyloCSF Frame 1

-4.63

No. of Spectra

2

CPC Coding Probability

0.145443

PhyloCSF Frame 2 

-4.525

CNTI Index

noncoding

Max Probability

0.8799

PhyloCSF Frame 3

-5.131

CNTI Score

-0.362895524