McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A10-9:3

Chromosome

chr20

Gene Name

lnc-SLC2A10-9

Start

46406786

CPC Label

noncoding

End

46455687

Cancer

OV

Strand

+

Peptide

GCSCSVYSLMGETPHLCPSK

Modified Peptide

n[145]GCSCSVYSLMGETPHLCPSK

Peptide Length

20

ORF Length

63

Open Reading Frame (ORF)

MGNAVLHCPEEVTRDRCLVAPPAHIQFHFRERGCSCSVYSLMGETPHLCPSKVLVLGTKLKVP

Conservation Score

0.758

PhyloCSF Frame 1

-4.163

No. of Spectra

2

CPC Coding Probability

0.0902383

PhyloCSF Frame 2 

-3.956

CNTI Index

noncoding

Max Probability

0.0812

PhyloCSF Frame 3

-4.517

CNTI Score

-0.337892339