McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A10-8:1

Chromosome

chr20

Gene Name

lnc-SLC2A10-8

Start

46997595

CPC Label

noncoding

End

46998488

Cancer

HCC

Strand

+

Peptide

AVEHSDIKK

Modified Peptide

AVEHSDIKK

Peptide Length

9

ORF Length

74

Open Reading Frame (ORF)

LPVPSLPIWQAVVRWPWDCSECIQWHCQGCGKVIPELNRKLADTASYVPTLSVSVQDLTCHLEKAVEHSDIKKM

Conservation Score

1

PhyloCSF Frame 1

-3.671

No. of Spectra

24

CPC Coding Probability

0.0445995

PhyloCSF Frame 2 

-4.26

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-4.096

CNTI Score

-0.363529206