McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A1-2:2

Chromosome

chr1

Gene Name

lnc-SLC2A1-2

Start

42959064

CPC Label

noncoding

End

42961791

Cancer

PRAD

Strand

-

Peptide

ASAAEPVLK

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

36

Open Reading Frame (ORF)

LGLHHESLRVAQRFSRSLVIHPRASAAEPVLKVLTG

Conservation Score

0.114

PhyloCSF Frame 1

-5.196

No. of Spectra

1

CPC Coding Probability

0.0113287

PhyloCSF Frame 2 

-4.167

CNTI Index

noncoding

Max Probability

0.8358

PhyloCSF Frame 3

-4.656

CNTI Score

-0.348524566