McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A1-2:1

Chromosome

chr1

Gene Name

lnc-SLC2A1-2

Start

42959157

CPC Label

noncoding

End

42961864

Cancer

OSCC

Strand

-

Peptide

LTMGSHVSVPGK

Modified Peptide

n[145]LTM[147]GSHVSVPGK

Peptide Length

12

ORF Length

37

Open Reading Frame (ORF)

MRLTMGSHVSVPGKVASMGLAQRRTRWLFGECDPWAE

Conservation Score

0.174

PhyloCSF Frame 1

-4.485

No. of Spectra

1

CPC Coding Probability

0.0119971

PhyloCSF Frame 2 

-6.372

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

-5.34

CNTI Score

-0.337302794