McDonnell Genome Institute

Washington University

Transcript

lnc-SLC2A1-1:1

Chromosome

chr1

Gene Name

lnc-SLC2A1-1

Start

42970248

CPC Label

noncoding

End

42983356

Cancer

OV

Strand

-

Peptide

TVAHTCNPSTK

Modified Peptide

n[145]TVAHTCNPSTK

Peptide Length

11

ORF Length

33

Open Reading Frame (ORF)

MLGLRTVAHTCNPSTKLFLPAPLILEKSGPGDS

Conservation Score

0.14

PhyloCSF Frame 1

-5.097

No. of Spectra

1

CPC Coding Probability

0.0200458

PhyloCSF Frame 2 

-2.764

CNTI Index

noncoding

Max Probability

0.4619

PhyloCSF Frame 3

-2.348

CNTI Score

-0.431697457