McDonnell Genome Institute

Washington University

Transcript

lnc-SLC29A4-5:7

Chromosome

chr7

Gene Name

lnc-SLC29A4-5

Start

5424057

CPC Label

coding

End

5465918

Cancer

OSCC

Strand

+

Peptide

NLAMRAGAVAQACNSSALGGQGRR

Modified Peptide

n[145]NLAMRAGAVAQACNSSALGGQGRR

Peptide Length

24

ORF Length

33

Open Reading Frame (ORF)

LKTRPPKNLAMRAGAVAQACNSSALGGQGRRIT

Conservation Score

0.457

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.703977

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5968

PhyloCSF Frame 3

0

CNTI Score

-0.275604218