McDonnell Genome Institute

Washington University

Transcript

lnc-SLC29A4-5:5

Chromosome

chr7

Gene Name

lnc-SLC29A4-5

Start

5424057

CPC Label

noncoding

End

5449180

Cancer

HCC

Strand

+

Peptide

AGAGVGK

Modified Peptide

n[230]AGAGVGK

Peptide Length

7

ORF Length

150

Open Reading Frame (ORF)

LRGQNSPQRDRRLAILMLGPQARSRQVPPPHFGRRDFEKKAGRAGAGVGKGNSRKGPGTGALEPWWPPRPDPPLDRCKDSGSGPKDPNTFLSSPFNLLSAESKLMPAAETSFRRRAGLGISLALAAFLGGEEGKAGEGRETGLEGARRFT

Conservation Score

0.102

PhyloCSF Frame 1

-2.801

No. of Spectra

6

CPC Coding Probability

0.294431

PhyloCSF Frame 2 

-2.465

CNTI Index

noncoding

Max Probability

0.9191

PhyloCSF Frame 3

-2.675

CNTI Score

-0.247997602