McDonnell Genome Institute

Washington University

Transcript

lnc-SLC29A4-5:14

Chromosome

chr7

Gene Name

lnc-SLC29A4-5

Start

5428183

CPC Label

coding

End

5465918

Cancer

OV

Strand

+

Peptide

AGNGQAFTDPLMTPR

Modified Peptide

n[145]AGNGQAFTDPLMTPR

Peptide Length

15

ORF Length

243

Open Reading Frame (ORF)

LGKDRDALSAQGAGCGHKSPGGPSFPLLTPGCSGPVSCPGPRRAPCSPHHGLGTRRLRREPRQELLRSPKRGNGLVPRCQHHPSLRALDPEVARASQDHRLGRGGNRPSRWCLTSAKQTMGAIGANHLQRGFAPDLRCTETGAFSPSWMPPENLTMPVTRLQTAGGTCRGLGMGGFGNLAPRTPSALPGAPGVHFLSCLPPPRLRPLWGRTWVLGELGWRRAGNGQAFTDPLMTPRSSEPSGP

Conservation Score

0.998

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.723384

PhyloCSF Frame 2 

0.976

CNTI Index

noncoding

Max Probability

0.8421

PhyloCSF Frame 3

1.248

CNTI Score

-0.275604218