McDonnell Genome Institute

Washington University

Transcript

lnc-SLC28A1-4:1

Chromosome

chr15

Gene Name

lnc-SLC28A1-4

Start

85105692

CPC Label

noncoding

End

85108154

Cancer

PRAD

Strand

+

Peptide

QAAAGHPYLPLNAR

Modified Peptide

Peptide Length

14

ORF Length

81

Open Reading Frame (ORF)

LERVQCCVSDRRSRCQGCSRDGRRSSCADAVHSWETVRDERQAAAGHPYLPLNARKFFISETLKDFEQGSHRIRVADLTEL

Conservation Score

0.204

PhyloCSF Frame 1

-4.452

No. of Spectra

1

CPC Coding Probability

0.164008

PhyloCSF Frame 2 

-3.718

CNTI Index

noncoding

Max Probability

0.1881

PhyloCSF Frame 3

-4.372

CNTI Score

-0.373539265