McDonnell Genome Institute

Washington University

Transcript

lnc-SLC27A5-3:2

Chromosome

chr19

Gene Name

lnc-SLC27A5-3

Start

58468154

CPC Label

coding

End

58476001

Cancer

OV

Strand

-

Peptide

AAPQSAHTK

Modified Peptide

n[145]AAPQSAHTK

Peptide Length

9

ORF Length

105

Open Reading Frame (ORF)

MRRWLSSTAPLAKALPQSTQRKGRSPVCRSWCWVRLELWLKARPHCGQAKGFSPVCTRWCLKSEEPWLKAAPQSAHTKGFSPVCVRSCWIRCELRQKRRPHCAQA

Conservation Score

1

PhyloCSF Frame 1

14.256

No. of Spectra

2

CPC Coding Probability

0.997767

PhyloCSF Frame 2 

-3.96

CNTI Index

coding

Max Probability

0.5536

PhyloCSF Frame 3

-4.836

CNTI Score

0.765414676