McDonnell Genome Institute

Washington University

Transcript

lnc-SLC26A8-1:7

Chromosome

chr6

Gene Name

lnc-SLC26A8-1

Start

36139292

CPC Label

noncoding

End

36196646

Cancer

OSCC

Strand

-

Peptide

LESCAISQREQNGLPSSQAR

Modified Peptide

n[145]LESCAISQREQNGLPSSQAR

Peptide Length

20

ORF Length

48

Open Reading Frame (ORF)

LESCAISQREQNGLPSSQARAHFCLCSSQSPSLLLFHILIAYHSPKIT

Conservation Score

1

PhyloCSF Frame 1

-1.807

No. of Spectra

1

CPC Coding Probability

0.149297

PhyloCSF Frame 2 

-0.974

CNTI Index

noncoding

Max Probability

0.3336

PhyloCSF Frame 3

-3.369

CNTI Score

-0.305814613