McDonnell Genome Institute

Washington University

Transcript

lnc-SLC26A3-1:13

Chromosome

chr7

Gene Name

lnc-SLC26A3-1

Start

107736007

CPC Label

noncoding

End

107744025

Cancer

OV

Strand

-

Peptide

LAISPSMQSAQPGALLK

Modified Peptide

n[145]LAISPSMQSAQPGALLK

Peptide Length

17

ORF Length

34

Open Reading Frame (ORF)

LAISPSMQSAQPGALLKVLPSRKISLHHCPSGMS

Conservation Score

0.142

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.107892

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9768

PhyloCSF Frame 3

0

CNTI Score

-0.318330646