McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A51-4:2

Chromosome

chr9

Gene Name

lnc-SLC25A51-4

Start

37910723

CPC Label

noncoding

End

37912141

Cancer

BRCA-Luminal A

Strand

-

Peptide

AEASVATGFQSK

Modified Peptide

n[145]AEASVATGFQSK

Peptide Length

12

ORF Length

86

Open Reading Frame (ORF)

MAEASVATGFQSKEGLGCQKGFLWEARSGVYFINKKCSSLTGHLLKLRPQLLRSSSSPAGRPRAVLTEFSPSPFSASSNIPSFSVI

Conservation Score

0.736

PhyloCSF Frame 1

-3.997

No. of Spectra

1

CPC Coding Probability

0.153842

PhyloCSF Frame 2 

-5.143

CNTI Index

noncoding

Max Probability

0.7058

PhyloCSF Frame 3

-4.333

CNTI Score

-0.309787168