McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A48-8:3

Chromosome

chr5

Gene Name

lnc-SLC25A48-8

Start

135399888

CPC Label

noncoding

End

135402615

Cancer

OV

Strand

+

Peptide

MTGSFHSFSRK

Modified Peptide

n[145]MTGSFHSFSRK

Peptide Length

11

ORF Length

48

Open Reading Frame (ORF)

MTGSFHSFSRKCLPQTKDHIMTFMGHRHFCLHGPFPPLKRQLHWYKDK

Conservation Score

0.993

PhyloCSF Frame 1

-5.334

No. of Spectra

39

CPC Coding Probability

0.0537062

PhyloCSF Frame 2 

-5.356

CNTI Index

noncoding

Max Probability

0.9809

PhyloCSF Frame 3

-4.104

CNTI Score

-0.366604548