McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A48-7:2

Chromosome

chr5

Gene Name

lnc-SLC25A48-7

Start

135456429

CPC Label

noncoding

End

135458868

Cancer

EOGC

Strand

+

Peptide

LPSLHLSEAR

Modified Peptide

n[145]LPSLHLSEAR

Peptide Length

10

ORF Length

63

Open Reading Frame (ORF)

LPSLHLSEARRNAPGLWVGVCIHSAGCWLSGGRWELEVSRRESKSPKGKSWGSAGFTQPGSLG

Conservation Score

0.077

PhyloCSF Frame 1

-4.4

No. of Spectra

2

CPC Coding Probability

0.0676918

PhyloCSF Frame 2 

-5.378

CNTI Index

noncoding

Max Probability

0.7993

PhyloCSF Frame 3

-5.11

CNTI Score

-0.392769235