McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A48-3:3

Chromosome

chr5

Gene Name

lnc-SLC25A48-3

Start

135559576

CPC Label

noncoding

End

135563152

Cancer

OSCC

Strand

+

Peptide

AVLCGQK

Modified Peptide

n[145]AVLCGQK

Peptide Length

7

ORF Length

74

Open Reading Frame (ORF)

LLEKKQAIVAVGRHEGCVHGKAVLCGQKNSVQHPDGGWKPVVAFGHFTVSLFSLGRFLSIKSSMSSLKNLFEKE

Conservation Score

0.99

PhyloCSF Frame 1

-3.759

No. of Spectra

1

CPC Coding Probability

0.0184341

PhyloCSF Frame 2 

-4.536

CNTI Index

noncoding

Max Probability

0.1423

PhyloCSF Frame 3

-2.08

CNTI Score

-0.367637028