McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A48-3:1

Chromosome

chr5

Gene Name

lnc-SLC25A48-3

Start

135559576

CPC Label

noncoding

End

135634874

Cancer

OV

Strand

+

Peptide

HLGWECRK

Modified Peptide

n[145]HLGWECRK

Peptide Length

8

ORF Length

85

Open Reading Frame (ORF)

MGQQPSLKKERRKKTLLDVGCTAKHLGWECRKQAWNARNAAPVAKLWSHRQILFKNLLHARPALCHRVKKKPSSHSHIGESHLSR

Conservation Score

1

PhyloCSF Frame 1

-4.348

No. of Spectra

1

CPC Coding Probability

0.176491

PhyloCSF Frame 2 

-3.395

CNTI Index

noncoding

Max Probability

0.5126

PhyloCSF Frame 3

-4.681

CNTI Score

-0.341973933