McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A47-5:1

Chromosome

chr14

Gene Name

lnc-SLC25A47-5

Start

100279375

CPC Label

noncoding

End

100282787

Cancer

LUAD

Strand

+

Peptide

QHWDVLR

Modified Peptide

n[230]QHWDVLR

Peptide Length

7

ORF Length

80

Open Reading Frame (ORF)

LIFHKVASLIKLTAFHETPRCCKKKKQHWDVLRRGQFAVLCSVCCSLWGPHNVRTHHGGEKGISTKRNNLFFLHCPYPDM

Conservation Score

0.817

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.184639

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9952

PhyloCSF Frame 3

0

CNTI Score

-0.338848888