McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A45-1:1

Chromosome

chr11

Gene Name

lnc-SLC25A45-1

Start

65308986

CPC Label

noncoding

End

65314137

Cancer

BRCA-Luminal B

Strand

-

Peptide

EMGEIQVPR

Modified Peptide

n[145]EMGEIQVPR

Peptide Length

9

ORF Length

119

Open Reading Frame (ORF)

LLSIYQVPSAVLVPGDSASGLGPAAQRREMGEIQVPRYIMIPFQVASPSWKLPSPAAIAPPWDLGDGVGSPLRQHWPDWRDQQGSSLLPPGRLKPALHGHETWNPGPWGAGEMTGTWGL

Conservation Score

1

PhyloCSF Frame 1

-4.52

No. of Spectra

6

CPC Coding Probability

0.141575

PhyloCSF Frame 2 

-3.736

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-3.391

CNTI Score

-0.360588708