McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A38-3:1

Chromosome

chr3

Gene Name

lnc-SLC25A38-3

Start

39358519

CPC Label

noncoding

End

39360059

Cancer

EOGC

Strand

+

Peptide

MGMEKTHINIVVIGHVDLGK

Modified Peptide

n[145]M[147]GM[147]EKTHINIVVIGHVDLGK

Peptide Length

20

ORF Length

67

Open Reading Frame (ORF)

MGMEKTHINIVVIGHVDLGKSTTTGHLIYKCGGIDKRTTEKFEKKAAGAGKVTKLPRKVRRLNEYYP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0733316

PhyloCSF Frame 2 

-3.771

CNTI Index

noncoding

Max Probability

0.4963

PhyloCSF Frame 3

-2.379

CNTI Score

-0.352549885