McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A37-1:9

Chromosome

chr8

Gene Name

lnc-SLC25A37-1

Start

23486973

CPC Label

noncoding

End

23494926

Cancer

EOGC

Strand

+

Peptide

LSCAVWVCR

Modified Peptide

n[145]LSCAVWVCR

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

LSCAVWVCRRASHGPSSYSQPTAPKSKPGSVPIHRDRMGAADLA

Conservation Score

0.031

PhyloCSF Frame 1

-4.717

No. of Spectra

1

CPC Coding Probability

0.0303235

PhyloCSF Frame 2 

-6.71

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-4.671

CNTI Score

-0.347705453