McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A29-1:2

Chromosome

chr14

Gene Name

lnc-SLC25A29-1

Start

100278848

CPC Label

noncoding

End

100291010

Cancer

BRCA-Basal-like

Strand

-

Peptide

SNIIIVHLR

Modified Peptide

n[145]SNIIIVHLR

Peptide Length

9

ORF Length

38

Open Reading Frame (ORF)

MRFCCIMAVYKVFSSLLFDLRSNIIIVHLRGYNVRGTH

Conservation Score

1

PhyloCSF Frame 1

-3.516

No. of Spectra

39

CPC Coding Probability

0.14592

PhyloCSF Frame 2 

-3.27

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-3.537

CNTI Score

-0.357104914