McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A28-1:2

Chromosome

chr10

Gene Name

lnc-SLC25A28-1

Start

99644512

CPC Label

noncoding

End

99659249

Cancer

BRCA-Luminal B

Strand

-

Peptide

LLTNPQLK

Modified Peptide

n[145]LLTNPQLK

Peptide Length

8

ORF Length

46

Open Reading Frame (ORF)

LEWTSSKLLTNPQLKVLTVRRKTNKQKGHPHQNPICTSPSSKTKGR

Conservation Score

0.648

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.149437

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0

CNTI Score

-0.311814837