McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A25-5:3

Chromosome

chr9

Gene Name

lnc-SLC25A25-5

Start

127981241

CPC Label

noncoding

End

127985642

Cancer

HCC

Strand

+

Peptide

LTFFFFFFFSDRVLLLLPR

Modified Peptide

n[230]LTFFFFFFFSDRVLLLLPR

Peptide Length

19

ORF Length

75

Open Reading Frame (ORF)

LGLQACTMRLAKLTFFFFFFFSDRVLLLLPRLECNGLILAHHNLHLPGSSDSPASVSQVAGIIGMCHHARLILYF

Conservation Score

0.051

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0964784

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6241

PhyloCSF Frame 3

0

CNTI Score

-0.3633016